PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100153790021
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family HB-other
Protein Properties Length: 187aa    MW: 21205.1 Da    PI: 9.4939
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100153790021genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox46.18.3e-1554892156
                                  HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                      Homeobox 21 knrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                                  ++++p++++r eL+k+l+L++rqVk+WFqNrR+++k
  Ote100153790021|100153790021 54 ECPHPDEKQRLELSKRLSLETRQVKFWFQNRRTQMK 89
                                  589******************************999 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003898.4E-74695IPR001356Homeobox domain
PfamPF000463.0E-125489IPR001356Homeobox domain
CDDcd000864.38E-105491No hitNo description
Gene3DG3DSA:1.10.10.601.2E-135499IPR009057Homeodomain-like
SuperFamilySSF466891.8E-125496IPR009057Homeodomain-like
PROSITE profilePS5007113.075691IPR001356Homeobox domain
PROSITE patternPS0002706689IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 187 aa     Download sequence    Send to blast
MWGEGGAEMK STRADLGATT WTVHLVMIKK IPTALXXXXX PPTHTAANPR TRIECPHPDE  60
KQRLELSKRL SLETRQVKFW FQNRRTQMKT QLERHENSIL RQENDKLRAE NMSXXXXXXX  120
XRNPICTNCG GTAMIGDVSL EEQHLRIENA RLKEELDRVC TLAGKFLGRP IPALAAAAPV  180
PNSSLEL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007051914.11e-70HD domain class transcription factor isoform 3, partial
RefseqXP_015961616.14e-70PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2-like isoform X1
RefseqXP_016198931.14e-70PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2-like isoform X1
SwissprotQ0WV122e-62ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLA0A022R5Y74e-71A0A022R5Y7_ERYGU; Uncharacterized protein (Fragment)
TrEMBLA0A061DVH82e-70A0A061DVH8_THECC; HD domain class transcription factor isoform 3 (Fragment)
STRINGSolyc01g091630.2.15e-69(Solanum lycopersicum)